PDB entry 1q0e

View 1q0e on RCSB PDB site
Description: Atomic resolution (1.15 ) crystal structure of bovine copper, zinc superoxide dismutase
Class: oxidoreductase, metal binding protein
Keywords: bovine, superoxide dismutase, atomic resolution, copper, zinc, OXIDOREDUCTASE, METAL BINDING PROTEIN
Deposited on 2003-07-16, released 2003-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.131
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q0ea_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q0eb_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0eA (A:)
    atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneestktgnagsrlacgvigiak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0eB (B:)
    atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneestktgnagsrlacgvigiak