PDB entry 1q0d

View 1q0d on RCSB PDB site
Description: Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the oxidized state
Deposited on 2003-07-16, released 2004-05-18
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-15, with a file datestamp of 2004-06-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.172
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1q0da_
  • Chain 'B':
    Domains in SCOP 1.69: d1q0db_
  • Chain 'C':
    Domains in SCOP 1.69: d1q0dc_
  • Chain 'D':
    Domains in SCOP 1.69: d1q0dd_
  • Chain 'E':
    Domains in SCOP 1.69: d1q0de_
  • Chain 'F':
    Domains in SCOP 1.69: d1q0df_
  • Chain 'G':
    Domains in SCOP 1.69: d1q0dg_
  • Chain 'H':
    Domains in SCOP 1.69: d1q0dh_
  • Chain 'I':
    Domains in SCOP 1.69: d1q0di_
  • Chain 'J':
    Domains in SCOP 1.69: d1q0dj_
  • Chain 'K':
    Domains in SCOP 1.69: d1q0dk_
  • Chain 'L':
    Domains in SCOP 1.69: d1q0dl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0dA (A:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0dB (B:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0dC (C:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0dD (D:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0dE (E:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0dF (F:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0dG (G:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0dH (H:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0dI (I:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0dJ (J:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0dK (K:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0dL (L:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka