PDB entry 1q0b

View 1q0b on RCSB PDB site
Description: Crystal structure of the motor protein KSP in complex with ADP and monastrol
Class: cell cycle
Keywords: cell cycle, motor protein, monastrol
Deposited on 2003-07-15, released 2004-01-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11 OR KNSL1 OR EG5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1q0ba_
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11 OR KNSL1 OR EG5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1q0bb_
  • Heterogens: MG, ADP, NAT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q0bA (A:)
    asqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladks
    srktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegersp
    neeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvser
    lqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsv
    tihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvita
    lvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahrakniln
    kpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0bA (A:)
    gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas
    tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi
    iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi
    ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel
    vkigklnlvdlagseninqslltlgrvitalvertphvpyreskltrilqdslggrtrts
    iiatispaslnleetlstleyahraknilnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q0bB (B:)
    asqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladks
    srktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegersp
    neeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvser
    lqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsv
    tihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvita
    lvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahrakniln
    kpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0bB (B:)
    gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas
    tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi
    iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi
    ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel
    vkigklnlvdlagseninqslltlgrvitalvertphvpyreskltrilqdslggrtrts
    iiatispaslnleetlstleyahraknilnkpevn