PDB entry 1q09

View 1q09 on RCSB PDB site
Description: Crystal structure of the Zn(II) form of E. coli ZntR, a zinc-sensing transcriptional regulator (space group I4122)
Class: transcription
Keywords: MerR family transcriptional regulator, Zn(II)-responsive regulator of zntA, TRANSCRIPTION
Deposited on 2003-07-15, released 2003-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.255
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zn(II)-responsive regulator of zntA
    Species: Escherichia coli [TaxId:562]
    Gene: ZNTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q09a_
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q09A (A:)
    sdlqrlkfirharqlgfslesirellsiridpehhtcqeskgivqerlqeveariaelqs
    mqrslqrlndaccgtahssvycsilealeqgasgvksgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q09A (A:)
    dlqrlkfirharqlgfslesirellsiridpehhtcqeskgivqerlqeveariaelqsm
    qrslqrlndaccgtahssvycsilealeqg