PDB entry 1q08

View 1q08 on RCSB PDB site
Description: Crystal structure of the Zn(II) form of E. coli ZntR, a zinc-sensing transcriptional regulator, at 1.9 A resolution (space group P212121)
Class: transcription
Keywords: MerR family transcriptional regulator, Zn(II)-responsive regulator of zntA
Deposited on 2003-07-15, released 2003-09-16
The last revision prior to the SCOP 1.75 freeze date was dated 2003-09-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zn(II)-responsive regulator of zntA
    Species: Escherichia coli
    Gene: ZNTR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1q08a_
  • Chain 'B':
    Compound: Zn(II)-responsive regulator of zntA
    Species: Escherichia coli
    Gene: ZNTR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1q08b_
  • Heterogens: PO4, ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q08A (A:)
    sdlqrlkfirharqlgfslesirellsiridpehhtcqeskgivqerlqeveariaelqs
    mqrslqrlndaccgtahssvycsilealeqgasgvksgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q08A (A:)
    sdlqrlkfirharqlgfslesirellsiridpehhtcqeskgivqerlqeveariaelqs
    mqrslqrlndaccgtahssvycsilealeqgasg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q08B (B:)
    sdlqrlkfirharqlgfslesirellsiridpehhtcqeskgivqerlqeveariaelqs
    mqrslqrlndaccgtahssvycsilealeqgasgvksgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q08B (B:)
    lqrlkfirharqlgfslesirellsiridpehhtcqeskgivqerlqeveariaelqsmq
    rslqrlndaccgtahssvycsilealeqg