PDB entry 1q06

View 1q06 on RCSB PDB site
Description: Crystal structure of the Ag(I) form of E. coli CueR, a copper efflux regulator
Class: transcription
Keywords: MerR family transcriptional regulator, copper efflux regulator
Deposited on 2003-07-15, released 2003-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.219
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator cueR
    Species: Escherichia coli [TaxId:562]
    Gene: CUER
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q06a_
  • Chain 'B':
    Compound: Transcriptional regulator cueR
    Species: Escherichia coli [TaxId:562]
    Gene: CUER
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q06b_
  • Heterogens: AG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q06A (A:)
    mnisdvakitgltskairfyeekglvtppmrsengyrtytqqhlneltllrqarqvgfnl
    eesgelvnlfndpqrhsadvkrrtlekvaeierhieelqsmrdqllalanacpgddsadc
    piienlsgcchhrag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q06A (A:)
    mnisdvakitgltskairfyeekglvtppmrsengyrtytqqhlneltllrqarqvgfnl
    eesgelvnlfndpqrhsadvkrrtlekvaeierhieelqsmrdqllalanacpgcpiien
    ls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q06B (B:)
    mnisdvakitgltskairfyeekglvtppmrsengyrtytqqhlneltllrqarqvgfnl
    eesgelvnlfndpqrhsadvkrrtlekvaeierhieelqsmrdqllalanacpgddsadc
    piienlsgcchhrag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q06B (B:)
    mnisdvakitgltskairfyeekglvtppmrsengyrtytqqhlneltllrqarqvgfnl
    eesgelvnlfndpqhsadvkrrtlekvaeierhieelqsmrdqllalanacpgddsadcp
    iienls