PDB entry 1q03

View 1q03 on RCSB PDB site
Description: Crystal structure of FGF-1, S50G/V51G mutant
Class: hormone/growth factor
Keywords: beta-trefoil, hormone/growth factor COMPLEX
Deposited on 2003-07-15, released 2004-07-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (Start-142)
      • engineered (55-56)
    Domains in SCOPe 2.04: d1q03a_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (Start-142)
      • engineered (55-56)
    Domains in SCOPe 2.04: d1q03b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q03A (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaegggev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q03A (A:)
    hhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaegggevyik
    stetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsc
    krgprthygqkailflplpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q03B (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaegggev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q03B (B:)
    hhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaegggevyik
    stetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsc
    krgprthygqkailflplpvs