PDB entry 1q02

View 1q02 on RCSB PDB site
Description: NMR structure of the UBA domain of p62 (SQSTM1)
Class: protein binding
Keywords: helical bundle, PROTEIN BINDING
Deposited on 2003-07-15, released 2003-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sequestosome 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13501 (2-51)
    • cloning artifact (0-1)
  Domains in SCOPe 2.06: d1q02a1, d1q02a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q02A (A:)
  gsppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh