PDB entry 1pzz

View 1pzz on RCSB PDB site
Description: Crystal structure of FGF-1, V51N mutant
Class: hormone/growth factor
Keywords: beta-trefoil, hormone/growth factor COMPLEX
Deposited on 2003-07-14, released 2004-07-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (6-End)
      • expression tag (6)
      • engineered (56)
    Domains in SCOPe 2.04: d1pzza_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (6-End)
      • expression tag (6)
      • engineered (56)
    Domains in SCOPe 2.04: d1pzzb_
  • Heterogens: SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pzzA (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesngev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzzA (A:)
    hhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesngevyik
    stetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsc
    krgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pzzB (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesngev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzzB (B:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesngevy
    ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    sckrgprthygqkailflplpv