PDB entry 1pzw

View 1pzw on RCSB PDB site
Description: Crystal structure of the zinc finger associated domain of the Drosophila transcription factor Grauzone
Class: transcription
Keywords: dimerization, transcription regulation, treble-clef zinc finger, ZAD, transcription
Deposited on 2003-07-14, released 2003-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.242
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor grauzone
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: grauzone
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pzwa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzwA (A:)
    dicrlclrgvsgaqmclqifdvdsgeskvaevlrqhfwfevlpndeiskvicnvcwtqvs
    efhqfyvsiqeaqviyatts