PDB entry 1pzw

View 1pzw on RCSB PDB site
Description: Crystal structure of the zinc finger associated domain of the Drosophila transcription factor Grauzone
Class: transcription
Keywords: dimerization, transcription regulation, treble-clef zinc finger, ZAD, transcription
Deposited on 2003-07-14, released 2003-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcription factor grauzone
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: grauzone
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9U405 (0-79)
  Domains in SCOPe 2.08: d1pzwa_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pzwA (A:)
  dicrlclrgvsgaqmclqifdvdsgeskvaevlrqhfwfevlpndeiskvicnvcwtqvs
  efhqfyvsiqeaqviyatts