PDB entry 1pzv

View 1pzv on RCSB PDB site
Description: Crystal structures of two UBC (E2) enzymes of the ubiquitin-conjugating system in Caenorhabditis elegans
Class: ligase
Keywords: alpha-beta(4)-alpha(3), core, meander beta-sheet plus one helix 2, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, ligase
Deposited on 2003-07-14, released 2003-07-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.241
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ubiquitin-conjugating enzyme E2-19 kDa
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: F58A4.10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1pzva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pzvA (A:)
    meqsslllkkqladmrrvpvdgfsaglvddndiykwevlvigppdtlyeggffkaildfp
    rdypqkppkmkfiseiwhpnidkegnvcisilhdpgddkwgyerpeerwlpvhtvetill
    svismltdpnfespanvdaakmqrenyaefkkkvaqcvrrsqee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzvA (A:)
    sslllkkqladmrrvpvdgfsaglvddndiykwevlvigppdtlyeggffkaildfprdy
    pqkppkmkfiseiwhpnidkegnvcisilhdppeerwlpvhtvetillsvismltdpnfe
    spanvdaakmqrenyaefkkkvaqcvrrsqee