PDB entry 1pzs

View 1pzs on RCSB PDB site
Description: Crystal Structure of a Cu-Zn Superoxide Dismutase from Mycobacterium tuberculosis at 1.63 resolution
Class: oxidoreductase, metal binding protein
Keywords: Cu-protein, beta core, antioxidant, metal binding, greek key beta barrel, oxidoreductase, metal binding protein
Deposited on 2003-07-14, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: SODC OR RV0432 OR MT0447 OR MTCY22G10.29
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pzsa_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pzsA (A:)
    csspqhastvpgttpsiwtgspapsglsghdeespgaqsltstltapdgtkvatakfefa
    ngyatvtiattgvgkltpgfhglhihqvgkcepnsvaptggapgnflsagghyhvpghtg
    tpasgdlaslqvrgdgsamlvtttdaftmddllsgaktaiiihagadnfanipperyvqv
    ngtpgpdettlttgdagkrvacgvigsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzsA (A:)
    qsltstltapdgtkvatakfefangyatvtiattgvgkltpgfhglhihqvgkcepnsva
    ptggapgnflsagghyhvpghtgtpasgdlaslqvrgdgsamlvtttdaftmddllsgak
    taiiihagadnfanipperyvqvngtpgpdettlttgdagkrvacgvigsg