PDB entry 1pzq

View 1pzq on RCSB PDB site
Description: Structure of fused docking domains from the erythromycin polyketide synthase (DEBS), a model for the interaction between DEBS 2 and DEBS 3: The A domain
Class: transferase
Keywords: four helix bundle, homodimer, transferase
Deposited on 2003-07-14, released 2004-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erythronolide synthase
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Gene: eryA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03132 (2-59)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1pzqa1, d1pzqa2
  • Chain 'B':
    Compound: erythronolide synthase
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Gene: eryA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03132 (2-59)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1pzqb1, d1pzqb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pzqA (A:)
gsaaspavdigdrldelekalealsaedghddvgqrlesllrrwnsrradapstsaised

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pzqB (B:)
gsaaspavdigdrldelekalealsaedghddvgqrlesllrrwnsrradapstsaised