PDB entry 1pzn

View 1pzn on RCSB PDB site
Description: Rad51 (RadA)
Deposited on 2003-07-12, released 2003-09-09
The last revision prior to the SCOP 1.69 freeze date was dated 2003-09-09, with a file datestamp of 2003-09-09.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.257
AEROSPACI score: -1.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1pzna1, d1pzna2
  • Chain 'B':
    Domains in SCOP 1.69: d1pznb1
  • Chain 'C':
    Domains in SCOP 1.69: d1pznc1
  • Chain 'D':
    Domains in SCOP 1.69: d1pznd1
  • Chain 'E':
    Domains in SCOP 1.69: d1pzne1
  • Chain 'F':
    Domains in SCOP 1.69: d1pznf1
  • Chain 'G':
    Domains in SCOP 1.69: d1pzng1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pznA (A:)
    mageevkeidefeelgfepateetpkkkkkekiirsiedlpgvgpataeklreagydtle
    aiavaspielkevagisegtalkiiqaarkaanlgtfmradeylkkratigristgsksl
    dkllgggietqaitevfgefgsgktqlahtlavmvqlppeegglngsviwidtentfrpe
    rireiaqnrgldpdevlkhiyvarafnsnhqmllvqqaedkikellntdrpvkllivdsl
    tshfrseyigrgalaerqqklakhladlhrlanlydiavfvtnqvqarpdaffgdptrpi
    gghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pznA (A:)
    rsiedlpgvgpataeklreagydtleaiavaspielkevagisegtalkiiqaarkaanl
    gtfmradeylkkratigristgsksldkllgggietqaitevfgefgsgktqlahtlavm
    vqlppeegglngsviwidtentfrperireiaqnrgldpdevlkhiyvarafnsnhqmll
    vqqaedkikellntdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanl
    ydiavfvtnqvqghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pznB (B:)
    mageevkeidefeelgfepateetpkkkkkekiirsiedlpgvgpataeklreagydtle
    aiavaspielkevagisegtalkiiqaarkaanlgtfmradeylkkratigristgsksl
    dkllgggietqaitevfgefgsgktqlahtlavmvqlppeegglngsviwidtentfrpe
    rireiaqnrgldpdevlkhiyvarafnsnhqmllvqqaedkikellntdrpvkllivdsl
    tshfrseyigrgalaerqqklakhladlhrlanlydiavfvtnqvqarpdaffgdptrpi
    gghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pznB (B:)
    tfmradeylkkratigristgsksldkllgggietqaitevfgefgsgktqlahtlavmv
    qlppeegglngsviwidtentfrperireiaqnrgldpdevlkhiyvarafnsnhqmllv
    qqaedkikellntdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanly
    diavfvtnqvqghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pznC (C:)
    mageevkeidefeelgfepateetpkkkkkekiirsiedlpgvgpataeklreagydtle
    aiavaspielkevagisegtalkiiqaarkaanlgtfmradeylkkratigristgsksl
    dkllgggietqaitevfgefgsgktqlahtlavmvqlppeegglngsviwidtentfrpe
    rireiaqnrgldpdevlkhiyvarafnsnhqmllvqqaedkikellntdrpvkllivdsl
    tshfrseyigrgalaerqqklakhladlhrlanlydiavfvtnqvqarpdaffgdptrpi
    gghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pznC (C:)
    tfmradeylkkratigristgsksldkllgggietqaitevfgefgsgktqlahtlavmv
    qlppeegglngsviwidtentfrperireiaqnrgldpdevlkhiyvarafnsnhqmllv
    qqaedkikellntdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanly
    diavfvtnqvqghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pznD (D:)
    mageevkeidefeelgfepateetpkkkkkekiirsiedlpgvgpataeklreagydtle
    aiavaspielkevagisegtalkiiqaarkaanlgtfmradeylkkratigristgsksl
    dkllgggietqaitevfgefgsgktqlahtlavmvqlppeegglngsviwidtentfrpe
    rireiaqnrgldpdevlkhiyvarafnsnhqmllvqqaedkikellntdrpvkllivdsl
    tshfrseyigrgalaerqqklakhladlhrlanlydiavfvtnqvqarpdaffgdptrpi
    gghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pznD (D:)
    tfmradeylkkratigristgsksldkllgggietqaitevfgefgsgktqlahtlavmv
    qlppeegglngsviwidtentfrperireiaqnrgldpdevlkhiyvarafnsnhqmllv
    qqaedkikellntdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanly
    diavfvtnqvqghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1pznE (E:)
    mageevkeidefeelgfepateetpkkkkkekiirsiedlpgvgpataeklreagydtle
    aiavaspielkevagisegtalkiiqaarkaanlgtfmradeylkkratigristgsksl
    dkllgggietqaitevfgefgsgktqlahtlavmvqlppeegglngsviwidtentfrpe
    rireiaqnrgldpdevlkhiyvarafnsnhqmllvqqaedkikellntdrpvkllivdsl
    tshfrseyigrgalaerqqklakhladlhrlanlydiavfvtnqvqarpdaffgdptrpi
    gghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pznE (E:)
    tfmradeylkkratigristgsksldkllgggietqaitevfgefgsgktqlahtlavmv
    qlppeegglngsviwidtentfrperireiaqnrgldpdevlkhiyvarafnsnhqmllv
    qqaedkikellntdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanly
    diavfvtnqvqghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pznF (F:)
    mageevkeidefeelgfepateetpkkkkkekiirsiedlpgvgpataeklreagydtle
    aiavaspielkevagisegtalkiiqaarkaanlgtfmradeylkkratigristgsksl
    dkllgggietqaitevfgefgsgktqlahtlavmvqlppeegglngsviwidtentfrpe
    rireiaqnrgldpdevlkhiyvarafnsnhqmllvqqaedkikellntdrpvkllivdsl
    tshfrseyigrgalaerqqklakhladlhrlanlydiavfvtnqvqarpdaffgdptrpi
    gghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pznF (F:)
    tfmradeylkkratigristgsksldkllgggietqaitevfgefgsgktqlahtlavmv
    qlppeegglngsviwidtentfrperireiaqnrgldpdevlkhiyvarafnsnhqmllv
    qqaedkikellntdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanly
    diavfvtnqvqghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1pznG (G:)
    mageevkeidefeelgfepateetpkkkkkekiirsiedlpgvgpataeklreagydtle
    aiavaspielkevagisegtalkiiqaarkaanlgtfmradeylkkratigristgsksl
    dkllgggietqaitevfgefgsgktqlahtlavmvqlppeegglngsviwidtentfrpe
    rireiaqnrgldpdevlkhiyvarafnsnhqmllvqqaedkikellntdrpvkllivdsl
    tshfrseyigrgalaerqqklakhladlhrlanlydiavfvtnqvqarpdaffgdptrpi
    gghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pznG (G:)
    tfmradeylkkratigristgsksldkllgggietqaitevfgefgsgktqlahtlavmv
    qlppeegglngsviwidtentfrperireiaqnrgldpdevlkhiyvarafnsnhqmllv
    qqaedkikellntdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanly
    diavfvtnqvqhilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied