PDB entry 1pzl

View 1pzl on RCSB PDB site
Description: crystal structure of hnf4a lbd in complex with the ligand and the coactivator src-1 peptide
Deposited on 2003-07-11, released 2004-06-01
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1pzla_
  • Chain 'B':
    Domains in SCOP 1.69: d1pzlb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pzlA (A:)
    ssyelaslpsinallqaevlsrqitspvsgingdirakkiasiadvcesmkeqllvlvew
    akyipafcelplddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaem
    srvsirildelvlpfqelqiddneyaylkaiiffdpdakglsdpgkikrlrsqvqvsled
    yindrqydsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzlA (A:)
    laslpsinallqaevlsrqitngdirakkiasiadvcesmkeqllvlvewakyipafcel
    plddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsirilde
    lvlpfqelqiddneyaylkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqydsr
    grfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllggs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzlB (B:)
    hkilhrllqegsps