PDB entry 1pzk

View 1pzk on RCSB PDB site
Description: Cholera Toxin B-Pentamer Complexed With N-Acyl Phenyl Galactoside 9h
Class: toxin
Keywords: pentamer, monovalent, toxin, inhibitor, cholera
Deposited on 2003-07-11, released 2004-03-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.134
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CAA41591
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pzkd_
  • Chain 'E':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CAA41591
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pzke_
  • Chain 'F':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CAA41591
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pzkf_
  • Chain 'G':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CAA41591
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pzkg_
  • Chain 'H':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CAA41591
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pzkh_
  • Heterogens: J12, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzkD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzkE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzkF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzkG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzkH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman