PDB entry 1pzg

View 1pzg on RCSB PDB site
Description: T.gondii LDH1 complexed with APAD and sulfate at 1.6 Angstroms
Class: oxidoreductase
Keywords: apicomplexa, APAD, tetramer, Rossmann fold, OXIDOREDUCTASE
Deposited on 2003-07-10, released 2004-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactate dehydrogenase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90613
      • modified residue (142)
      • cloning artifact (329)
    Domains in SCOPe 2.06: d1pzga1, d1pzga2, d1pzga3
  • Chain 'B':
    Compound: lactate dehydrogenase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90613
      • modified residue (142)
      • cloning artifact (329)
    Domains in SCOPe 2.06: d1pzgb1, d1pzgb2, d1pzgb3
  • Chain 'C':
    Compound: lactate dehydrogenase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90613
      • modified residue (142)
    Domains in SCOPe 2.06: d1pzgc1, d1pzgc2
  • Chain 'D':
    Compound: lactate dehydrogenase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90613
      • modified residue (142)
    Domains in SCOPe 2.06: d1pzgd1, d1pzgd2
  • Heterogens: SO4, A3D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pzgA (A:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzgA (A:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalqap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pzgB (B:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzgB (B:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalqap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pzgC (C:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzgC (C:)
    alvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdtn
    vsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikkyc
    pktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqat
    vigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgsa
    yyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervieleln
    eeekkqfqksvddvmalnkavaalq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pzgD (D:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzgD (D:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalq