PDB entry 1pzg

View 1pzg on RCSB PDB site
Description: T.gondii LDH1 complexed with APAD and sulfate at 1.6 Angstroms
Deposited on 2003-07-10, released 2004-02-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-24, with a file datestamp of 2004-02-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pzgA (A:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzgA (A:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalqap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pzgB (B:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzgB (B:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalqap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pzgC (C:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzgC (C:)
    alvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdtn
    vsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikkyc
    pktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqat
    vigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgsa
    yyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervieleln
    eeekkqfqksvddvmalnkavaalq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pzgD (D:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzgD (D:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
    cpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqa
    tvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgs
    ayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielel
    neeekkqfqksvddvmalnkavaalq