PDB entry 1pze

View 1pze on RCSB PDB site
Description: T.gondii LDH1 apo form
Class: oxidoreductase
Keywords: NADH-dependent, tetramer, Rossmann fold, OXIDOREDUCTASE
Deposited on 2003-07-10, released 2004-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.188
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactate dehydrogenase
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: lactate dehydrogenase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pzea1, d1pzea2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pzeA (A:)
    mapalvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvv
    dtnvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnik
    kycpktfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdv
    qatvigthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgq
    gsayyapaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagierviel
    elneeekkqfqksvddvmalnkavaalqapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzeA (A:)
    palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
    nvsvraeysyeaaltgadcvivtagltkvpgsewsrndllpfnskiireigqnikkycpk
    tfiivvtnpldcmvkvmceasgvptnmicgmacmldsgrfrryvadalsvsprdvqatvi
    gthgdcmvplvryitvngypiqkfikdgvvtekqleeiaehtkvsggeivrflgqgsayy
    apaasavamatsflndekrvipcsvycngeyglkdmfiglpaviggagiervielelnee
    ekkqfqksvddvmalnkavaalq