PDB entry 1pzb

View 1pzb on RCSB PDB site
Description: the crystal structures of reduced pseudoazurin from alcaligenes faecalis s-6 at two ph values
Deposited on 1994-08-03, released 1994-11-30
The last revision prior to the SCOP 1.57 freeze date was dated 1994-11-30, with a file datestamp of 1994-12-07.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1pzb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pzb_ (-)
    enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
    nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia