PDB entry 1pz8

View 1pz8 on RCSB PDB site
Description: Modulation of agrin function by alternative splicing and Ca2+ binding
Class: structural protein
Keywords: Agrin, STRUCTURAL PROTEIN
Deposited on 2003-07-10, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.22
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Agrin
    Species: Gallus gallus [TaxId:9031]
    Gene: AGRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31696
      • see remark 999 (41-43)
    Domains in SCOPe 2.08: d1pz8a_
  • Chain 'B':
    Compound: Agrin
    Species: Gallus gallus [TaxId:9031]
    Gene: AGRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31696
      • see remark 999 (41-43)
    Domains in SCOPe 2.08: d1pz8b_
  • Chain 'C':
    Compound: Agrin
    Species: Gallus gallus [TaxId:9031]
    Gene: AGRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31696
      • see remark 999 (41-43)
    Domains in SCOPe 2.08: d1pz8c_
  • Chain 'D':
    Compound: Agrin
    Species: Gallus gallus [TaxId:9031]
    Gene: AGRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31696
      • see remark 999 (41-43)
    Domains in SCOPe 2.08: d1pz8d_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pz8A (A:)
    ekviiekaagdaeaiafdgrtymeyhnavtkshlsneipaekalqsnhfelsikteatqg
    lilwsgkglersdyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqreg
    slqvgneapitgssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdr
    qelhlvedalnnptilhcsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pz8A (A:)
    eaiafdgrtymeyhnavaekalqsnhfelsikteatqglilwsgkglersdyialaivdg
    fvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgneapitgssplgatqld
    tdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlvedalnnptilhc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pz8B (B:)
    ekviiekaagdaeaiafdgrtymeyhnavtkshlsneipaekalqsnhfelsikteatqg
    lilwsgkglersdyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqreg
    slqvgneapitgssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdr
    qelhlvedalnnptilhcsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pz8B (B:)
    daeaiafdgrtymeyhnavtaekalqsnhfelsikteatqglilwsgkglersdyialai
    vdgfvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgneapitgssplgat
    qldtdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlvedalnnptilhc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pz8C (C:)
    ekviiekaagdaeaiafdgrtymeyhnavtkshlsneipaekalqsnhfelsikteatqg
    lilwsgkglersdyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqreg
    slqvgneapitgssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdr
    qelhlvedalnnptilhcsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pz8C (C:)
    aeaiafdgrtymeyhnavekalqsnhfelsikteatqglilwsgkglersdyialaivdg
    fvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgneapitgssplgatqld
    tdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlvedalnnptilhc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pz8D (D:)
    ekviiekaagdaeaiafdgrtymeyhnavtkshlsneipaekalqsnhfelsikteatqg
    lilwsgkglersdyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqreg
    slqvgneapitgssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdr
    qelhlvedalnnptilhcsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pz8D (D:)
    aeaiafdgrtymeyhnavaekalqsnhfelsikteatqglilwsgkglersdyialaivd
    gfvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgneapitgssplgatql
    dtdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlvedalnnptilhc