PDB entry 1pz7

View 1pz7 on RCSB PDB site
Description: Modulation of agrin function by alternative splicing and Ca2+ binding
Class: structural protein
Keywords: Agrin, STRUCTURAL PROTEIN
Deposited on 2003-07-10, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.221
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Agrin
    Species: Gallus gallus [TaxId:9031]
    Gene: AGRN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pz7a_
  • Chain 'B':
    Compound: Agrin
    Species: Gallus gallus [TaxId:9031]
    Gene: AGRN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pz7b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pz7A (A:)
    ekviiekaagdaeaiafdgrtymeyhnavtkspdaldypaepsekalqsnhfelsiktea
    tqglilwsgkglersdyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvq
    regslqvgneapitgssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvi
    vdrqelhlvedalnnptilhcsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pz7A (A:)
    kaagdaeaiafdgrtymeyhnavtksaepsekalqsnhfelsikteatqglilwsgkgle
    rsdyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgneapi
    tgssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlvedal
    nnptilhc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pz7B (B:)
    ekviiekaagdaeaiafdgrtymeyhnavtkspdaldypaepsekalqsnhfelsiktea
    tqglilwsgkglersdyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvq
    regslqvgneapitgssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvi
    vdrqelhlvedalnnptilhcsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pz7B (B:)
    daeaiafdgrtymeyhnavtksaepsekalqsnhfelsikteatqglilwsgkglersdy
    ialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgneapitgss
    plgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlvedalnnpt
    ilhcsak