PDB entry 1pz4
View 1pz4 on RCSB PDB site
Description: The structural determination of an insect (mosquito) Sterol Carrier Protein-2 with a ligand bound C16 Fatty Acid at 1.35 A resolution
Class: lipid binding protein
Keywords: alpha and beta, LIPID BINDING PROTEIN
Deposited on
2003-07-09, released
2003-09-30
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.187
AEROSPACI score: 0.71
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Sterol carrier protein 2
Species: Aedes aegypti [TaxId:7159]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1pz4a_ - Heterogens: PLM, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1pz4A (A:)
gspgirmslksdevfakiakrlesidpanrqvehvykfritqggkvvknwvmdlknvklv
esddaaeatltmeddimfaigtgalpakeamaqdkmevdgqvelifllepfiaslk
Sequence, based on observed residues (ATOM records): (download)
>1pz4A (A:)
girmslksdevfakiakrlesidpanrqvehvykfritqggkvvknwvmdlknvklvesd
daaeatltmeddimfaigtgalpakeamaqdkmevdgqvelifllepfiaslk