PDB entry 1pz4

View 1pz4 on RCSB PDB site
Description: The structural determination of an insect (mosquito) Sterol Carrier Protein-2 with a ligand bound C16 Fatty Acid at 1.35 A resolution
Deposited on 2003-07-09, released 2003-09-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-14, with a file datestamp of 2003-10-14.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pz4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pz4A (A:)
    gspgirmslksdevfakiakrlesidpanrqvehvykfritqggkvvknwvmdlknvklv
    esddaaeatltmeddimfaigtgalpakeamaqdkmevdgqvelifllepfiaslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pz4A (A:)
    girmslksdevfakiakrlesidpanrqvehvykfritqggkvvknwvmdlknvklvesd
    daaeatltmeddimfaigtgalpakeamaqdkmevdgqvelifllepfiaslk