PDB entry 1pz4

View 1pz4 on RCSB PDB site
Description: The structural determination of an insect (mosquito) Sterol Carrier Protein-2 with a ligand bound C16 Fatty Acid at 1.35 A resolution
Class: lipid binding protein
Keywords: alpha and beta, LIPID BINDING PROTEIN
Deposited on 2003-07-09, released 2003-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.187
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sterol carrier protein 2
    Species: Aedes aegypti [TaxId:7159]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86PR3 (6-115)
      • cloning artifact (3-5)
    Domains in SCOPe 2.07: d1pz4a1, d1pz4a2
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pz4A (A:)
    gspgirmslksdevfakiakrlesidpanrqvehvykfritqggkvvknwvmdlknvklv
    esddaaeatltmeddimfaigtgalpakeamaqdkmevdgqvelifllepfiaslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pz4A (A:)
    girmslksdevfakiakrlesidpanrqvehvykfritqggkvvknwvmdlknvklvesd
    daaeatltmeddimfaigtgalpakeamaqdkmevdgqvelifllepfiaslk