PDB entry 1pz1

View 1pz1 on RCSB PDB site
Description: Structure of NADPH-dependent family 11 aldo-keto reductase AKR11B(holo)
Class: oxidoreductase
Keywords: beta-alpha barrel, aldo-keto reductase, TIM barrel, OXIDOREDUCTASE
Deposited on 2003-07-09, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General stress protein 69
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YHDN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80874 (0-330)
      • modified residue (0)
      • modified residue (26)
      • modified residue (73)
      • modified residue (139)
      • modified residue (161)
      • modified residue (184)
      • modified residue (214)
      • modified residue (322)
      • cloning artifact (331-332)
    Domains in SCOPe 2.07: d1pz1a1, d1pz1a2
  • Chain 'B':
    Compound: General stress protein 69
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YHDN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80874 (0-330)
      • modified residue (0)
      • modified residue (26)
      • modified residue (73)
      • modified residue (139)
      • modified residue (161)
      • modified residue (184)
      • modified residue (214)
      • modified residue (322)
      • cloning artifact (331-332)
    Domains in SCOPe 2.07: d1pz1b1, d1pz1b2
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pz1A (A:)
    meytsiadtgieasriglgtwaiggtmwggtdektsietiraaldqgitlidtapaygfg
    qseeivgkaikeymkrdqvilatktaldwknnqlfrhanrariveevenslkrlqtdyid
    lyqvhwpdplvpieetaevmkelydagkiraigvsnfsieqmdtfravaplhtiqppynl
    feremeesvlpyakdnkittllygslcrglltgkmteeytfegddlrnhdpkfqkprfke
    ylsavnqldklaktrygksvihlavrwildqpgadialwgarkpgqlealseitgwtlns
    edqkdintilentisdpvgpefmapptreeipg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pz1B (B:)
    meytsiadtgieasriglgtwaiggtmwggtdektsietiraaldqgitlidtapaygfg
    qseeivgkaikeymkrdqvilatktaldwknnqlfrhanrariveevenslkrlqtdyid
    lyqvhwpdplvpieetaevmkelydagkiraigvsnfsieqmdtfravaplhtiqppynl
    feremeesvlpyakdnkittllygslcrglltgkmteeytfegddlrnhdpkfqkprfke
    ylsavnqldklaktrygksvihlavrwildqpgadialwgarkpgqlealseitgwtlns
    edqkdintilentisdpvgpefmapptreeipg