PDB entry 1pyx

View 1pyx on RCSB PDB site
Description: GSK-3 Beta complexed with AMP-PNP
Deposited on 2003-07-09, released 2003-10-21
The last revision prior to the SCOP 1.71 freeze date was dated 2003-10-21, with a file datestamp of 2003-10-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1pyxa_
  • Chain 'B':
    Domains in SCOP 1.71: d1pyxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pyxA (A:)
    gpmsgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytd
    tkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffys
    sgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgic
    hrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssi
    dvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqika
    hpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpa
    lfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasn
    st
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pyxA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssevylnlvldyvpetvyrvarhysrakqtlpviyvk
    lymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyics
    ryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptre
    qiremnpfkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdel
    rdpnvklpngrdtpalfnfttqelssnpplatilipphariqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pyxB (B:)
    gpmsgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytd
    tkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffys
    sgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgic
    hrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssi
    dvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqika
    hpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpa
    lfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasn
    st
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pyxB (B:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssevylnlvldyvpetvyrvarhysrakqtlpviyvk
    lymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyics
    ryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptre
    qiremfkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrd
    pnvklpngrdtpalfnfttqelssnpplatilipphar