PDB entry 1pyv

View 1pyv on RCSB PDB site
Description: NMR solution structure of the mitochondrial F1b presequence peptide from Nicotiana plumbaginifolia
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-07-09, released 2004-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase beta chain, mitochondrial precursor
    Species: Nicotiana plumbaginifolia [TaxId:4092]
    Gene: ATPB OR ATP2-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pyva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1pyvA (A:)
masrrllasllrqsaqrggglisrslgnsipksasrassraspkgfllnravqy

    Sequence, based on observed residues (ATOM records): (download) 
    >1pyvA (A:)
asrrllasllrqsaqrggglisrslgnsipksasrassraspkgfllnravqy