PDB entry 1pyt

View 1pyt on RCSB PDB site
Description: ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c
Class: ternary complex (zymogen)
Keywords: ternary complex (zymogen), serine proteinase, c-terminal peptidase
Deposited on 1995-06-21, released 1997-01-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.192
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: procarboxypeptidase a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pyta_
  • Chain 'B':
    Compound: procarboxypeptidase a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1pytb_
  • Chain 'C':
    Compound: proproteinase e
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05805 (Start-252)
      • conflict (76)
      • conflict (159)
      • conflict (172)
      • conflict (196)
      • conflict (246)
    Domains in SCOPe 2.01: d1pytc_
  • Chain 'D':
    Compound: chymotrypsinogen c
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PYT (0-250)
    Domains in SCOPe 2.01: d1pytd_
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pytA (A:)
    kedfvghqvlritaadeaevqtvkeledlehlqldfwrgpgqpgspidvrvpfpslqavk
    vfleahgiryrimiedvqslldeeqeqmfasqsr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pytB (B:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavealkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtlnnly
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pytC (C:)
    fsqpfsrpssrvvngedavpyswswqvslqyekdgafhhtcggsliapdwvvtaghcist
    srtyqvvlgeydrsvlqgseqvipinagdlfvhplwnsncvacgndialvklsrsaqlgd
    kvqlanlppagdilpneapcyisgwgrlytggplpdklqeallpvvdyehcsqydwwgit
    vkktmvcaggdtrsgcdgdsggplncpaadgswqvhgvtsfvsafgcntikkptvftrvs
    afidwinetiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pytC (C:)
    srpssrvvngedavpyswswqvslqyekdgafhhtcggsliapdwvvtaghcistsrtyq
    vvlgeydrsvlqgseqvipinagdlfvhplwnsncvacgndialvklsrsaqlgdkvqla
    nlppagdilpneapcyisgwgrlytggplpdklqeallpvvdyehcsqydwwgitvkktm
    vcaggdtrsgcdgdsggplncpaadgswqvhgvtsfvsafgcntikkptvftrvsafidw
    inetiasn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pytD (D:)
    cgapifqpnlsarvvggedaiphswpwqislqylrdntwrhtcggtlitpnhvltaahci
    sntltyrvalgknnlevedeagslyvgvdtifvhekwnsflvrndialiklaetvelgdt
    iqvaclpsegsllpqdypcfvtgwgrlytngpiaaelqqglqpvvdyatcsqrdwwgttv
    ketmvcaggdgvisacngdsggplncqadgqwdvrgivsfgsglscntfkkptvftrvsa
    yidwinqklql