PDB entry 1pyt

View 1pyt on RCSB PDB site
Description: ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c
Deposited on 1995-06-21, released 1997-01-27
The last revision prior to the SCOP 1.55 freeze date was dated 1997-01-27, with a file datestamp of 1997-01-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.192
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1pyta_
  • Chain 'B':
    Domains in SCOP 1.55: d1pytb_
  • Chain 'C':
    Domains in SCOP 1.55: d1pytc_
  • Chain 'D':
    Domains in SCOP 1.55: d1pytd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pytA (A:)
    kedfvghqvlritaadeaevqtvkeledlehlqldfwrgpgqpgspidvrvpfpslqavk
    vfleahgiryrimiedvqslldeeqeqmfasqsr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pytB (B:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavealkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtlnnly
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pytC (C:)
    srpssrvvngedavpyswswqvslqyekdgafhhtcggsliapdwvvtaghcistsrtyq
    vvlgeydrsvlqgseqvipinagdlfvhplwnsncvacgndialvklsrsaqlgdkvqla
    nlppagdilpneapcyisgwgrlytggplpdklqeallpvvdyehcsqydwwgitvkktm
    vcaggdtrsgcdgdsggplncpaadgswqvhgvtsfvsafgcntikkptvftrvsafidw
    inetiasn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pytD (D:)
    cgapifqpnlsarvvggedaiphswpwqislqylrdntwrhtcggtlitpnhvltaahci
    sntltyrvalgknnlevedeagslyvgvdtifvhekwnsflvrndialiklaetvelgdt
    iqvaclpsegsllpqdypcfvtgwgrlytngpiaaelqqglqpvvdyatcsqrdwwgttv
    ketmvcaggdgvisacngdsggplncqadgqwdvrgivsfgsglscntfkkptvftrvsa
    yidwinqklql