PDB entry 1pys

View 1pys on RCSB PDB site
Description: phenylalanyl-tRNA synthetase from thermus thermophilus
Class: aminoacyl-tRNA synthetase
Keywords: phenylalanyl-tRNA synthetase, class II aminoacyl-tRNA synthetase, thermus thermophilus, rbd domain, sh3 domain, helix-turn-helix motif, aminoacyl-tRNA synthetase
Deposited on 1996-11-14, released 1997-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.177
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pysa_
  • Chain 'B':
    Compound: phenylalanyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pysb1, d1pysb2, d1pysb3, d1pysb4, d1pysb5, d1pysb6
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pysA (A:)
    mleealaaiqnardleelkalkarylgkkglltqemkglsalpleerrkrgqelnaikaa
    leaalearekaleeaalkealerervdvslpgaslfsgglhpitlmerelveifralgyq
    avegpeveseffnfdalnipehhpardmwdtfwltgegfrlegplgeevegrlllrthts
    pmqvrymvahtppfrivvpgrvfrfeqtdatheavfhqleglvvgegiamahlkgaiyel
    aqalfgpdskvrfqpvyfpfvepgaqfavwwpeggkwlelggagmvhpkvfqavdayrer
    lglppayrgvtgfafglgverlamlrygipdiryffggrlkfleqfkgvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pysA (A:)
    rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
    ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
    feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
    aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
    lrygipdiryffggrlkfleqfkgvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pysB (B:)
    mrvpfswlkayvpelespevleerlaglgfetdriervfpiprgvvfarvleahpipgtr
    lkrlvldagrtvevvsgaenarkgigvalalpgtelpglgqkvgerviqgvrsfgmalsp
    relgvgeygggllefpedalppgtplseawpeevvldlevtpnrpdalgllglardlhal
    gyalvepeaalkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmr
    pinnvvdvtnyvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlvi
    agwrgeesfplglagvmggaesevredteaialevacfdpvsirktarrhglrteashrf
    ergvdplgqvpaqrralsllqalagarvaealleagspkppeaipfrpeyanrllgtsyp
    eaeqiailkrlgcrvegegptyrvtppshrldlrleedlveevariqgyetiplalpaff
    papdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllllnplape
    kaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegvglpwak
    erlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflgalhpeia
    qelelppvhlfelrlplpdkplafqdpsrhpaafrdlavvvpaptpygevealvreaagp
    yleslalfdlyqgpplpeghkslafhlrfrhpkrtlrdeeveeavsrvaealrargfglr
    gldtp