PDB entry 1pys

View 1pys on RCSB PDB site
Description: phenylalanyl-trna synthetase from thermus thermophilus
Deposited on 1996-11-14, released 1997-11-19
The last revision prior to the SCOP 1.55 freeze date was dated 1997-11-19, with a file datestamp of 1997-11-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.177
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pysA (A:)
    rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
    ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
    feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
    aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
    lrygipdiryffggrlkfleqfkgvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pysB (B:)
    mrvpfswlkayvpelespevleerlaglgfetdriervfpiprgvvfarvleahpipgtr
    lkrlvldagrtvevvsgaenarkgigvalalpgtelpglgqkvgerviqgvrsfgmalsp
    relgvgeygggllefpedalppgtplseawpeevvldlevtpnrpdalgllglardlhal
    gyalvepeaalkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmr
    pinnvvdvtnyvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlvi
    agwrgeesfplglagvmggaesevredteaialevacfdpvsirktarrhglrteashrf
    ergvdplgqvpaqrralsllqalagarvaealleagspkppeaipfrpeyanrllgtsyp
    eaeqiailkrlgcrvegegptyrvtppshrldlrleedlveevariqgyetiplalpaff
    papdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllllnplape
    kaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegvglpwak
    erlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflgalhpeia
    qelelppvhlfelrlplpdkplafqdpsrhpaafrdlavvvpaptpygevealvreaagp
    yleslalfdlyqgpplpeghkslafhlrfrhpkrtlrdeeveeavsrvaealrargfglr
    gldtp