PDB entry 1pyp

View 1pyp on RCSB PDB site
Description: x-ray diffraction study of inorganic pyrophosphatase from baker,s yeast at the 3 angstroms resolution (russian)
Class: acid anhydride hydrolase
Keywords: acid anhydride hydrolase
Deposited on 1983-02-03, released 1983-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00817 (0-End)
      • conflict (39)
      • conflict (70)
      • conflict (115)
      • conflict (121)
      • conflict (134)
      • conflict (184)
      • conflict (222)
      • conflict (264)
    Domains in SCOPe 2.07: d1pypa_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00817 (0-End)
      • conflict (39)
      • conflict (70)
      • conflict (115)
      • conflict (121)
      • conflict (134)
      • conflict (184)
      • conflict (222)
      • conflict (264)
    Domains in SCOPe 2.07: d1pypb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pypA (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkednifnmvveiprwtnakleit
    keetlnpiiqntkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdnnpidv
    lqigetiaytgqvkevkalgimalldegetdwkviaidindplapklndiedvekyfpgl
    lratdewfriykipdgkpenqfafsgeaknkkyaldiikethnswkqliagkssdskgid
    ltnvtlpdtptyskaasdaippaspkadapidksidkwffisgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pypA (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkednifnmvveiprwtnakleit
    keetlnpiiqntkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdnnpidv
    lqigetiaytgqvkevkalgimalldegetdwkviaidindplapklndiedvekyfpgl
    lratdewfriykipdgkpenqfafsgeaknkkyaldiikethnswkqliagkssdskgid
    ltnvtlpdtptyskaasdaippaspkadapidksidkwffi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pypB (B:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkednifnmvveiprwtnakleit
    keetlnpiiqntkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdnnpidv
    lqigetiaytgqvkevkalgimalldegetdwkviaidindplapklndiedvekyfpgl
    lratdewfriykipdgkpenqfafsgeaknkkyaldiikethnswkqliagkssdskgid
    ltnvtlpdtptyskaasdaippaspkadapidksidkwffisgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pypB (B:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkednifnmvveiprwtnakleit
    keetlnpiiqntkgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdnnpidv
    lqigetiaytgqvkevkalgimalldegetdwkviaidindplapklndiedvekyfpgl
    lratdewfriykipdgkpenqfafsgeaknkkyaldiikethnswkqliagkssdskgid
    ltnvtlpdtptyskaasdaippaspkadapidksidkwffi