PDB entry 1pyo

View 1pyo on RCSB PDB site
Description: Crystal Structure of Human Caspase-2 in Complex with Acetyl-Leu-Asp-Glu-Ser-Asp-cho
Class: hydrolase/hydrolase inhibitor
Keywords: apoptosis, caspase, alpha-beta, thiol protease, hydrolase-hydrolase inhibitor complex
Deposited on 2003-07-09, released 2003-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.189
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caspase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP2 OR ICH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pyo.1
  • Chain 'B':
    Compound: Caspase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP2 OR ICH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pyo.1
  • Chain 'C':
    Compound: Caspase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP2 OR ICH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pyo.2
  • Chain 'D':
    Compound: Caspase-2
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP2 OR ICH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pyo.2
  • Chain 'E':
    Compound: acetyl-leu-asp-glu-ser-asj
    Species: Saccharomyces cerevisiae (Baker's yeast), synthetic [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: acetyl-leu-asp-glu-ser-asj
    Species: Saccharomyces cerevisiae (Baker's yeast), synthetic [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pyoA (A:)
    nkdgpvclqvkpctpefyqthfqlayrlqsrprglalvlsnvhftgekelefrsggdvdh
    stlvtlfkllgydvhvlcdqtaqemqeklqnfaqlpahrvtdscivallshgvegaiygv
    dgkllqlqevfqlfdnancpslqnkpkmffiqacrgdetdrgvdqqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pyoA (A:)
    lqvkpctpefyqthfqlayrlqsrprglalvlsnvhftgekelefrsggdvdhstlvtlf
    kllgydvhvlcdqtaqemqeklqnfaqlpahrvtdscivallshgvegaiygvdgkllql
    qevfqlfdnancpslqnkpkmffiqacrgdetdrgvdqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pyoB (B:)
    agkeklpkmrlptrsdmicgyaclkgtaamrntkrgswyiealaqvfseracdmhvadml
    vkvnalikdregyapgtefhrckemseycstlcrhlylfpghppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pyoB (B:)
    pkmrlptrsdmicgyaclkgtaamrntkrgswyiealaqvfseracdmhvadmlvkvnal
    ikdregyapgtefhrckemseycstlcrhlylfpghpp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pyoC (C:)
    nkdgpvclqvkpctpefyqthfqlayrlqsrprglalvlsnvhftgekelefrsggdvdh
    stlvtlfkllgydvhvlcdqtaqemqeklqnfaqlpahrvtdscivallshgvegaiygv
    dgkllqlqevfqlfdnancpslqnkpkmffiqacrgdetdrgvdqqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pyoC (C:)
    clqvkpctpefyqthfqlayrlqsrprglalvlsnvhftgekelefrsggdvdhstlvtl
    fkllgydvhvlcdqtaqemqeklqnfaqlpahrvtdscivallshgvegaiygvdgkllq
    lqevfqlfdnancpslqnkpkmffiqacrgdetdrgvdqqd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pyoD (D:)
    agkeklpkmrlptrsdmicgyaclkgtaamrntkrgswyiealaqvfseracdmhvadml
    vkvnalikdregyapgtefhrckemseycstlcrhlylfpghppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pyoD (D:)
    pkmrlptrsdmicgyaclkgtaamrntkrgswyiealaqvfseracdmhvadmlvkvnal
    ikdregyapgtefhrckemseycstlcrhlylfpghppt
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.