PDB entry 1pym

View 1pym on RCSB PDB site
Description: phosphoenolpyruvate mutase from mollusk in with bound mg2-oxalate
Class: phosphotransferase
Keywords: phosphotransferase, phosphomutase, p-c bond formation
Deposited on 1999-02-25, released 1999-07-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phosphoenolpyruvate mutase)
    Species: Mytilus edulis [TaxId:6550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1pyma_
  • Chain 'B':
    Compound: protein (phosphoenolpyruvate mutase)
    Species: Mytilus edulis [TaxId:6550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1pymb_
  • Heterogens: OXL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pymA (A:)
    mstkvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsn
    easwtqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpk
    tnslhdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayr
    nagadailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanh
    nlrasvsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pymA (A:)
    vkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsneasw
    tqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpktnsl
    hdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayrnaga
    dailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlra
    svsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pymB (B:)
    mstkvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsn
    easwtqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpk
    tnslhdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayr
    nagadailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanh
    nlrasvsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pymB (B:)
    vkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsneasw
    tqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpktnsl
    hdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayrnaga
    dailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlra
    svsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylp