PDB entry 1pyl

View 1pyl on RCSB PDB site
Description: Crystal structure of Ribonuclease Sa2
Deposited on 2003-07-09, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-13, with a file datestamp of 2004-07-13.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.15
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1pyla_
  • Chain 'B':
    Domains in SCOP 1.69: d1pylb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pylA (A:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pylA (A:)
    dpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvt
    pgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pylB (B:)
    adpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvv
    tpgsndrgtrrvvtggygeqywspdhyatfqeidprc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pylB (B:)
    aladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpg
    sndrgtrrvvtggygeqywspdhyatfqeidprc