PDB entry 1pyf

View 1pyf on RCSB PDB site
Description: Structure of NADPH-dependent family 11 aldo-keto reductase AKR11A(apo)
Deposited on 2003-07-08, released 2004-03-23
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-23, with a file datestamp of 2004-03-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pyfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pyfA (A:)
    mkkaklgksdlqvfpiglgtnavgghnlypnlneetgkelvreairngvtmldtayiygi
    grseeligevlrefnredvviatkaahrkqgndfvfdnspdflkksvdeslkrlntdyid
    lfyihfpdehtpkdeavnalnemkkagkirsigvsnfsleqlkeankdglvdvlqgeynl
    lnreaektffpytkehnisfipyfplvsgllagkytedttfpegdlrneqehfkgerfke
    nirkvnklapiaekhnvdiphivlawylarpeidilipgakradqlidniktadvtlsqe
    disfidklfapg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pyfA (A:)
    kkaklgksdlqvfpiglgtnavgghnlypnlneetgkelvreairngvtmldtayiygig
    rseeligevlrefnredvviatkaahrkqgndfvfdnspdflkksvdeslkrlntdyidl
    fyihfpdehtpkdeavnalnemkkagkirsigvsnfsleqlkeankdglvdvlqgeynll
    nreaektffpytkehnisfipyfplvsgllagkytedttfpegdlrneqehfkgerfken
    irkvnklapiaekhnvdiphivlawylarpeidilipgakradqlidniktadvtlsqed
    isfidklfapg