PDB entry 1pyd

View 1pyd on RCSB PDB site
Description: catalytic centers in the thiamin diphosphate dependent enzyme pyruvate decarboxylase at 2.4 angstroms resolution
Class: lyase(carbon-carbon)
Keywords: lyase(carbon-carbon)
Deposited on 1993-03-23, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate decarboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06169 (1-555)
      • conflict (54)
      • conflict (142)
      • conflict (205)
      • conflict (207)
      • conflict (537)
      • conflict (550)
    Domains in SCOPe 2.07: d1pyda1, d1pyda2, d1pyda3
  • Chain 'B':
    Compound: pyruvate decarboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06169 (1-555)
      • conflict (54)
      • conflict (142)
      • conflict (205)
      • conflict (207)
      • conflict (537)
      • conflict (550)
    Domains in SCOPe 2.07: d1pydb1, d1pydb2, d1pydb3
  • Heterogens: MG, TDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pydA (A:)
    mseitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadg
    yarikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsissqakqlllhhtlgng
    dftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakl
    lqtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqf
    pafvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsys
    yktknivefhsdhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavp
    astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli
    hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieiml
    pvfdapqnlvkqaklt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pydA (A:)
    seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
    arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsishhtlgngdftvfhrms
    anisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakllqtpidmsl
    kpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfpafvtpmgk
    gsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdktknivefhsdhmkirna
    tfpgvqmkfvlqklltniadaakgykpvavpartpanaavpastplkqewmwnqlgnflq
    egdvviaetgtsafginqttfpnntygisqvlwgsigfttgatlgaafaaeeidpkkrvi
    lfigdgslqltvqeistmirwglkpylfvlnndgytieklihgpkaqyneiqgwdhlsll
    ptfgakdyethrvattgewdkltqdksfndnskirmieimlpvfdapqnlvkqaklt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pydB (B:)
    mseitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadg
    yarikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsissqakqlllhhtlgng
    dftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakl
    lqtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqf
    pafvtpmgkgsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsys
    yktknivefhsdhmkirnatfpgvqmkfvlqklltniadaakgykpvavpartpanaavp
    astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli
    hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieiml
    pvfdapqnlvkqaklt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pydB (B:)
    seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
    arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsishhtlgngdftvfhrms
    anisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakllqtpidmsl
    kpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfpafvtpmgk
    gsiseqhpryggvyvgtlskpevkeavesadlilsvgallsdktknivefhsdhmkirna
    tfpgvqmkfvlqklltniadaakgykpvavpartpanaavpastplkqewmwnqlgnflq
    egdvviaetgtsafginqttfpnntygisqvlwgsigfttgatlgaafaaeeidpkkrvi
    lfigdgslqltvqeistmirwglkpylfvlnndgytieklihgpkaqyneiqgwdhlsll
    ptfgakdyethrvattgewdkltqdksfndnskirmieimlpvfdapqnlvkqaklt