PDB entry 1pyc

View 1pyc on RCSB PDB site
Description: cyp1 (hap1) dna-binding domain (residues 60-100), nmr, 15 structures
Deposited on 1996-02-17, released 1996-08-01
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1pyc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pyc_ (-)
    iplscticrkrkvkcdklrphcqqctktgvahlchymeqtw