PDB entry 1pyb

View 1pyb on RCSB PDB site
Description: Crystal Structure of Aquifex aeolicus Trbp111: a Structure-Specific tRNA Binding Protein
Class: RNA binding protein
Keywords: oligonucleotide, oligosaccharide-binding fold, OB-fold, beta-barrel, RNA BINDING PROTEIN
Deposited on 2003-07-08, released 2003-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionyl-tRNA synthetase beta subunit
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: metG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pyba_
  • Chain 'B':
    Compound: methionyl-tRNA synthetase beta subunit
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: metG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pybb_
  • Chain 'C':
    Compound: methionyl-tRNA synthetase beta subunit
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: metG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pybc_
  • Chain 'D':
    Compound: methionyl-tRNA synthetase beta subunit
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: metG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pybd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pybA (A:)
    meekaligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpee
    lvgkkivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pybA (A:)
    aligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpeelvgk
    kivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pybB (B:)
    meekaligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpee
    lvgkkivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pybB (B:)
    aligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpeelvgk
    kivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pybC (C:)
    meekaligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpee
    lvgkkivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pybC (C:)
    aligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpeelvgk
    kivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pybD (D:)
    meekaligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpee
    lvgkkivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pybD (D:)
    aligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpeelvgk
    kivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls