PDB entry 1py4

View 1py4 on RCSB PDB site
Description: Beta2 microglobulin mutant H31Y displays hints for amyloid formations
Deposited on 2003-07-08, released 2004-05-04
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.241
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1py4a_
  • Chain 'B':
    Domains in SCOP 1.71: d1py4b_
  • Chain 'C':
    Domains in SCOP 1.71: d1py4c_
  • Chain 'D':
    Domains in SCOP 1.71: d1py4d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1py4A (A:)
    miqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1py4A (A:)
    miqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1py4B (B:)
    miqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1py4B (B:)
    iqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskdw
    sfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1py4C (C:)
    miqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1py4C (C:)
    qrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskdws
    fyllyyteftptekdeyacrvnhvtlsqpkivkwdr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1py4D (D:)
    miqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskd
    wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1py4D (D:)
    iqrtpkiqvysrhpaengksnflncyvsgfypsdievdllkngeriekvehsdlsfskdw
    sfyllyyteftptekdeyacrvnhvtlsqpkivkwdr