PDB entry 1py0

View 1py0 on RCSB PDB site
Description: Crystal structure of E51C/E54C Psaz from A.faecalis with CLaNP probe
Class: electron transport
Keywords: cupredoxin, NMR probe, ELECTRON TRANSPORT
Deposited on 2003-07-07, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04377 (2-End)
      • cloning artifact (0-1)
      • engineered (52)
      • engineered (55)
    Domains in SCOPe 2.08: d1py0a1, d1py0a2
  • Heterogens: ZN, Y1, SO4, YMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1py0A (A:)
asenievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipcgackfks
kinenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekv
iasak

    Sequence, based on observed residues (ATOM records): (download) 
    >1py0A (A:)
asenievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipcgackfks
kinenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekv
ia