PDB entry 1pxz

View 1pxz on RCSB PDB site
Description: 1.7 angstrom crystal structure of jun a 1, the major allergen from cedar pollen
Deposited on 2003-07-07, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1pxza_
  • Chain 'B':
    Domains in SCOP 1.71: d1pxzb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxzA (A:)
    dnpidscwrgdsnwdqnrmkladcavgfgsstmggkggdfytvtstddnpvnptpgtlry
    gatrekalwiifsqnmniklkmplyvaghktidgrgadvhlgnggpclfmrkvshvilhs
    lhihgcntsvlgdvlvsesigvepvhaqdgdaitmrnvtnawidhnslsdcsdglidvtl
    gstgitisnnhffnhhkvmllghddtydddksmkvtvafnqfgpnagqrmpraryglvhv
    annnydpwniyaiggssnptilsegnsftapsesykkevtkrigcespsacanwvwrstr
    dafingayfvssgkteetniynsneafkvengnaapqltknagvvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxzB (B:)
    dnpidscwrgdsnwdqnrmkladcavgfgsstmggkggdfytvtstddnpvnptpgtlry
    gatrekalwiifsqnmniklkmplyvaghktidgrgadvhlgnggpclfmrkvshvilhs
    lhihgcntsvlgdvlvsesigvepvhaqdgdaitmrnvtnawidhnslsdcsdglidvtl
    gstgitisnnhffnhhkvmllghddtydddksmkvtvafnqfgpnagqrmpraryglvhv
    annnydpwniyaiggssnptilsegnsftapsesykkevtkrigcespsacanwvwrstr
    dafingayfvssgkteetniynsneafkvengnaapqltknagvvt