PDB entry 1pxz

View 1pxz on RCSB PDB site
Description: 1.7 Angstrom Crystal Structure of jun a 1, the major allergen from cedar pollen
Class: allergen
Keywords: parallel beta-helix, allergen, cedar pollen
Deposited on 2003-07-07, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major pollen allergen Jun a 1
    Species: Juniperus ashei [TaxId:13101]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pxza_
  • Chain 'B':
    Compound: Major pollen allergen Jun a 1
    Species: Juniperus ashei [TaxId:13101]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pxzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxzA (A:)
    dnpidscwrgdsnwdqnrmkladcavgfgsstmggkggdfytvtstddnpvnptpgtlry
    gatrekalwiifsqnmniklkmplyvaghktidgrgadvhlgnggpclfmrkvshvilhs
    lhihgcntsvlgdvlvsesigvepvhaqdgdaitmrnvtnawidhnslsdcsdglidvtl
    gstgitisnnhffnhhkvmllghddtydddksmkvtvafnqfgpnagqrmpraryglvhv
    annnydpwniyaiggssnptilsegnsftapsesykkevtkrigcespsacanwvwrstr
    dafingayfvssgkteetniynsneafkvengnaapqltknagvvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxzB (B:)
    dnpidscwrgdsnwdqnrmkladcavgfgsstmggkggdfytvtstddnpvnptpgtlry
    gatrekalwiifsqnmniklkmplyvaghktidgrgadvhlgnggpclfmrkvshvilhs
    lhihgcntsvlgdvlvsesigvepvhaqdgdaitmrnvtnawidhnslsdcsdglidvtl
    gstgitisnnhffnhhkvmllghddtydddksmkvtvafnqfgpnagqrmpraryglvhv
    annnydpwniyaiggssnptilsegnsftapsesykkevtkrigcespsacanwvwrstr
    dafingayfvssgkteetniynsneafkvengnaapqltknagvvt