PDB entry 1pxy

View 1pxy on RCSB PDB site
Description: Crystal structure of the actin-crosslinking core of Arabidopsis fimbrin
Class: structural protein
Keywords: CALPONIN HOMOLOGY, F-ACTIN-BINDING DOMAIN (ABD), F-ACTIN-CROSSLINKING, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, STRUCTURAL PROTEIN
Deposited on 2003-07-07, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fimbrin-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7G188 (Start-505)
      • engineered (122)
    Domains in SCOPe 2.07: d1pxya_
  • Chain 'B':
    Compound: fimbrin-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7G188 (5-505)
      • engineered (122)
    Domains in SCOPe 2.07: d1pxyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pxyA (A:)
    gspgiqsekgpfvqhinrylgddpflkqflpldphsnqlyelvkdgvllcklinvavpgt
    ideraintkrvlnpwernenhtlclnsakavgcsvvnigtqdlaegrphlvlglisqlik
    iqlladlnlkktpqlvelledsddveellrlppekvllkwmnfhlkkggykktvsnfsad
    lkdaqayafllnvlapehcdpatldakdpleraelvlshaermnckryltaeeivegsst
    lnlafvaqifhernglnkdgkyafaemmtedvetcrdercyrlwinslgidsyvnnvfed
    vrngwillevldkvspssvnwkhaskppikmpfrkvencnqvikigkqlkfslvnvagnd
    ivqgnkklilgllwqlmrfhmlqllkslrsrtlgkemtdadilswanrkvrtmgrklqie
    sfkdkslssglfflnllwaveprvvnwnlvtkgetddekrlnatyivsvarklgcsvfll
    pedivevnqkmililtasimywslqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pxyA (A:)
    sekgpfvqhinrylgddpflkqflpldphsnqlyelvkdgvllcklinvavpgtiderai
    ntkrvlnpwernenhtlclnsakavgcsvvnigtqdlaegrphlvlglisqlikiqllad
    lnlkklrlppekvllkwmnfhlkkggykktvsnfsadlkdaqayafllnvlapehcdpat
    ldakdpleraelvlshaermnckryltaeeivegsstlnlafvaqifhernglndvetcr
    dercyrlwinslgidsyvnnvfedvrngwillevldkvspssvnwkhaskppikmpfrkv
    encnqvikigkqlkfslvnvagndivqgnkklilgllwqlmrfhmlqllkslrsemtdad
    ilswanrkvrtmgrklqiesfkdkslssglfflnllwaveprvvnwnlvtkgetddekrl
    natyivsvarklgcsvfllpedivevnqkmililtasimywslqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pxyB (B:)
    gspgiqsekgpfvqhinrylgddpflkqflpldphsnqlyelvkdgvllcklinvavpgt
    ideraintkrvlnpwernenhtlclnsakavgcsvvnigtqdlaegrphlvlglisqlik
    iqlladlnlkktpqlvelledsddveellrlppekvllkwmnfhlkkggykktvsnfsad
    lkdaqayafllnvlapehcdpatldakdpleraelvlshaermnckryltaeeivegsst
    lnlafvaqifhernglnkdgkyafaemmtedvetcrdercyrlwinslgidsyvnnvfed
    vrngwillevldkvspssvnwkhaskppikmpfrkvencnqvikigkqlkfslvnvagnd
    ivqgnkklilgllwqlmrfhmlqllkslrsrtlgkemtdadilswanrkvrtmgrklqie
    sfkdkslssglfflnllwaveprvvnwnlvtkgetddekrlnatyivsvarklgcsvfll
    pedivevnqkmililtasimywslqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pxyB (B:)
    qsekgpfvqhinrylgddpflkqflpldphsnqlyelvkdgvllcklinvavpgtidera
    intkrvlnpwernenhtlclnsakavgcsvvnigtqdlaegrphlvlglisqlikiqlla
    dlnlkktpqlvedveellrlppekvllkwmnfhlkkggykktvsnfsadlkdaqayafll
    nvlapehcdpatldakdpleraelvlshaermnckryltaeeivegsstlnlafvaqifh
    ernglndvetcrdercyrlwinslgidsyvnnvfedvrngwillevldkvspssvnwkha
    skppikmpfrkvencnqvikigkqlkfslvnvagndivqgnkklilgllwqlmrfhmlql
    lkslgkemtdadilswanrkvrtmgrklqiesfkdkslssglfflnllwaveprvvnwnl
    vtkgetddekrlnatyivsvarklgcsvfllpedivevnqkmililtasimywslqr