PDB entry 1pxu

View 1pxu on RCSB PDB site
Description: Crystal structure of chicken NtA from a eukaryotic source at 2.2A resolution
Class: structural protein
Keywords: Agrin, STRUCTURAL PROTEIN
Deposited on 2003-07-07, released 2004-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Agrin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pxua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxuA (A:)
    ncperelqrreeeanvvltgtveeimnvdpvhhtysckvrvwrylkgkdivtheilldgg
    nkvviggfgdplicdnqvstgdtriffvnpapqymwpahrnelmlnsslmritlrnleev
    ehcveehrkll