PDB entry 1pxt

View 1pxt on RCSB PDB site
Description: the 2.8 angstroms structure of peroxisomal 3-ketoacyl-coa thiolase of saccharomyces cerevisiae: a five layered a-b-a-b-a structure, constructed from two core domains of identical topology
Class: thiolase
Keywords: thiolase
Deposited on 1994-07-04, released 1994-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxisomal 3-ketoacyl-coa thiolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pxta1, d1pxta2
  • Chain 'B':
    Compound: peroxisomal 3-ketoacyl-coa thiolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pxtb1, d1pxtb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pxtA (A:)
    llekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnliee
    vacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqidig
    lalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdqdef
    aansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafikdrgt
    ttagnasqvsdgvagvllarrsvanqlnlpvlgryidfqtvgvppeimgvgpayaipkvl
    eatglqvqdidifeineafaaqalycihklgidlnkvnprggaialghplgctgarqvat
    ilrelkkdqigvvsmcigtgmgaaaifike
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pxtA (A:)
    llekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnliee
    vacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqidig
    lalgvesmtnnyknqknreakkclipmgitnenrkdqdefaansyqkaykakneglfede
    ilpiklpdgsicqsdegprpqvsdgvagvllarrsvanqlnlpvlgryidfqtvgvppei
    mgvgpayaipkvleatglqvqdidifeineafaaqalycihklgidlnkvnprggaialg
    hplgctgarqvatilrelkkdqigvvsmcigtgmgaaaifike
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pxtB (B:)
    llekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnliee
    vacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqidig
    lalgvesmtnnyknvnplgmisseelqknreakkclipmgitnenvaanfkisrkdqdef
    aansyqkaykakneglfedeilpiklpdgsicqsdegprpnvtaeslssirpafikdrgt
    ttagnasqvsdgvagvllarrsvanqlnlpvlgryidfqtvgvppeimgvgpayaipkvl
    eatglqvqdidifeineafaaqalycihklgidlnkvnprggaialghplgctgarqvat
    ilrelkkdqigvvsmcigtgmgaaaifike
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pxtB (B:)
    llekrpedvvivaanrsaigkgfkgafkdvntdyllynflnefigrfpeplradlnliee
    vacgnvlnvgagatehraaclasgipystpfvalnrqcssgltavndiankikvgqidig
    lalgvesmtnnyknknreakkclmgitnenrkdqdefaansyqkaykakneglfedeilp
    iklpdgsicqsdegprpnvtaeslsqvsdgvagvllarrsvanqlnlpvlgryidfqtvg
    vppeimgvgpayaipkvleatglqvqdidifeineafaaqalycihklgidlnkvnprgg
    aialghplgctgarqvatilrelkkdqigvvsmcigtgmgaaaifike