PDB entry 1pxf

View 1pxf on RCSB PDB site
Description: Crystal Structure of Trbp111: a Structure Specific tRNA Binding Protein
Class: RNA binding protein
Keywords: oligonucleotide-oligosaccharide binding fold, OB fold, beta-barrel, RNA BINDING PROTEIN
Deposited on 2003-07-03, released 2003-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-02, with a file datestamp of 2008-11-28.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.149
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ygjH
    Species: Escherichia coli [TaxId:562]
    Gene: YGJH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42589 (0-109)
      • expression tag (110)
    Domains in SCOPe 2.07: d1pxfa1, d1pxfa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pxfA (A:)
    metvayadfarlemrvgkivevkrhenadklyivqvdvgqktlqtvtslvpyyseeelmg
    ktvvvlcnlqkakmrgetsecmllcaetddgsesvlltpermmpagvrvva