PDB entry 1px9

View 1px9 on RCSB PDB site
Description: Solution structure of the native CnErg1 Ergtoxin, a highly specific inhibitor of HERG channel
Class: toxin
Keywords: alpha/beta molecular scaffold, TOXIN
Deposited on 2003-07-03, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ergtoxin
  Species: Centruroides noxius [TaxId:6878]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q86QT3 (0-41)
  Domains in SCOPe 2.07: d1px9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1px9A (A:)
  drdscvdksrcakygyyqecqdccknaghnggtcmffkckca